PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000137305
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 351aa    MW: 37950.9 Da    PI: 6.1708
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000137305genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA54.12.1e-17254287134
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    C +C  tkTp+WR gp g+ktLCnaCG++y++ +
  MDP0000137305 254 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKSGR 287
                    99*****************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.5E-751336IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.424248284IPR000679Zinc finger, GATA-type
SMARTSM004019.3E-17248298IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.23E-15252311No hitNo description
Gene3DG3DSA:3.30.50.101.5E-14252285IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.69E-14253300No hitNo description
PROSITE patternPS003440254279IPR000679Zinc finger, GATA-type
PfamPF003204.4E-15254287IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009845Biological Processseed germination
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MIGQSFIDDI DCGSLFDTID DLLDFPTDDV ESALGPAPDC NAAFNSSSLW PSQSXSLQPP  60
NEAVFSGNSA SDLSAELDVP IEDIVQLEWL SNFCEDSFSG GSLTINKPDN SFVNNESSHR  120
QFQTSSPISV LDSSSSCSVE KXVPQSPGPV VPGKRGRARS KRPRPATFNP RPAIQLISPA  180
SSVTEAEALQ HQPLLPPKLH SDSENFAESR PVIKIPXQAS GEQKKKKKIK LTLPQAPAEG  240
NQSSGTTQGA VRKCLHCEIT KTPQWRAGPM GPKTLCNACG VRYKSGRLFP EYRPAASPTF  300
VPALHSNSHK KVIEMRNKGG ELVPFGETAR AMTETPELIP NANHSISLDY M
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160164KRPRP
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.50970.0bud| cell culture| fruit| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4525081e-58AM452508.1 Vitis vinifera, whole genome shotgun sequence, contig VV78X231684.10, clone ENTAV 115.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008347480.10.0PREDICTED: GATA transcription factor 8-like
TrEMBLM5XD360.0M5XD36_PRUPE; Uncharacterized protein
STRINGPOPTR_0010s23010.11e-139(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48873356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54810.22e-42GATA family protein